PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G177100.1.p
Common NameSb07g024890, SORBIDRAFT_07g024890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 259aa    MW: 28334.7 Da    PI: 9.4514
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G177100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.7e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.007G177100.1.p 14 KGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLMRCGKSCRLRWINYL 61
                          79********************************************97 PP

2Myb_DNA-binding574.5e-1867111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T++Ed+l+++++ +lG++ W++Ia++++ gRt++++k++w+++
  Sobic.007G177100.1.p  67 RGNFTADEDDLIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.8961IPR017930Myb domain
SMARTSM007172.8E-121363IPR001005SANT/Myb domain
SuperFamilySSF466892.88E-2913108IPR009057Homeodomain-like
PfamPF002499.2E-151461IPR001005SANT/Myb domain
CDDcd001675.32E-111661No hitNo description
PROSITE profilePS5129428.30862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2765116IPR009057Homeodomain-like
SMARTSM007172.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001672.12E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLVAYIR AHGEGCWRSL PKAAGLMRCG KSCRLRWINY  60
LRPDLKRGNF TADEDDLIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIRRKLLGRG  120
IDPVTHRPIA DAGAGTVTTI SFQPNKPNAA VAAQAPQHQP IKAVATAVVK VPRCPDLNLD  180
LCISPPCQQK EDEELDLKPA VVVKREVLQA GHGGSLCFGC SLGIQKGAPG CSCSSSNSHH  240
RFLGLRSGML DFRGLEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.80660.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794070.0HF679407.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB1 protein.
GenBankJQ2554770.0JQ255477.1 Saccharum hybrid cultivar Co 86032 MYB42 (MYB42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444621.10.0hypothetical protein SORBIDRAFT_07g024890
SwissprotP200251e-143MYB38_MAIZE; Myb-related protein Zm38
TrEMBLC5YH310.0C5YH31_SORBI; Putative uncharacterized protein Sb07g024890
STRINGSb07g024890.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34990.11e-94myb domain protein 32